PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10018673m
Common NameCICLE_v10018669mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Nin-like
Protein Properties Length: 1008aa    MW: 110295 Da    PI: 5.4318
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10018673mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.72.7e-29595646152
           RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Ciclev10018673m 595 AEKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 646
                      589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.745585666IPR003035RWP-RK domain
PfamPF020422.6E-26598646IPR003035RWP-RK domain
SuperFamilySSF542772.68E-23894984No hitNo description
Gene3DG3DSA:3.10.20.2403.4E-24897978No hitNo description
PROSITE profilePS5174523.136899981IPR000270PB1 domain
SMARTSM006665.7E-23899981IPR000270PB1 domain
CDDcd064072.25E-33900980No hitNo description
PfamPF005643.0E-17902980IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1008 aa     Download sequence    Send to blast
MEHPFSPKEK GTGYWASPRA PMEPLDCGTR NSNSGDLFNN FSDLLNFDAY AGWCNSPSVT  60
DQMFASYGFS SFQSTPCASF DTSNVMASNS SVASEGGGTS NAMESSFDRG DRIGFQQTST  120
DCYPINTNDA DDLVPKQSSG VYRENNTNMS NSMICRPVPP SLDEKMLRAL SFFKLSSGGG  180
ILAQVWVPRK QGDDYILSTS DQPYLLDQML AGYREVSRKF TFSAEAKPGT FLGLPGRVFS  240
SKVPEWTSNV AYYNEAEYAR VTHAVNHAVR SCIALPVFQF PEMSCSAVLE IVSVKEKPNF  300
DAEIENICNA LQAVNLRTTA PPRLLPQNIS RNQKAALAEI TDVLRAVCHA HRLPLALTWI  360
PCNYDEEAVD EVIKVRVRHS NTSSDGKSVL CIEGTACYVN DSDMQGFVHA CSEHYLEEGQ  420
GVAGKALQSN HPFFFPDVKL YDITEFPLVH HARKFGLNAA VAIRLRSTYT GDDDYILEFF  480
LPVTIKGSSE QQLLLNNLSG TMQRMCRSLR TVSDAELIQD EGSKFGFQKE VVSNFPPMVM  540
SRRNSQSALL DSDFNSIEKI TLSVSNSKSG LEADGPPEQV MSGSRRHMEK KRSTAEKNVS  600
LSVLQQYFSG SLKDAAKSIG VCPTTLKRIC RQHGISRWPS RKINKVNRSL KKIQTVLNSV  660
QGVEGGLKFD PTTGGFVAAG SIIQEFDAQK SSLHPDKNMP VRNSESITKD STSIPPTLSI  720
DGEKFVVKVE EDECSVDKNQ VGPLSMLIQN SSKGELNKSS VNLIDCSEDS KLILTDAGPF  780
WQARLGTAAW DSPDTASMVS YYAKGGEKGA RSKNGLQLES SDCHFVSQSS NSLAAADNMD  840
TRREGDDGII ENNQPTTSST TDSSNGSGSL AHASSVSSPS FEEGKHLKIH PGSDDIGSKI  900
IVKATYKEDI IRFKFDPSAG CFQLYEEVAR RLKLQNGTFQ LKYLDDEEEW VMLVSDSDLQ  960
ECFDILESLG KRSVRFLVRD ISCNVGSSGS SNCFLAGSSS CFLAGVS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.123770.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0562710.0KX056271.1 Citrus trifoliata transcription factor NLP8 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006442936.10.0hypothetical protein CICLE_v10018669mg
RefseqXP_015386041.10.0PREDICTED: protein NLP9-like isoform X2
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLV4U2300.0V4U230_9R
STRINGPOPTR_0017s04980.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein